PNC-27 PureRawz

PureRawz PNC-27 Peptide

PureRawz PNC-27 is a high-purity synthetic peptide engineered from a p53-derived domain and designed for advanced laboratory investigations. This specialized peptide contains a membrane-localizing sequence that enables researchers to study peptide-membrane interactions, cellular signaling pathways, and membrane integrity mechanisms under controlled conditions.

PNC-27 has gained significant attention in molecular biology and cellular research because of its unique structure and its potential role in investigating peptide-mediated responses in cultured cell models. Researchers commonly utilize this peptide for in vitro studies involving membrane perturbation, apoptosis-associated pathways, and cellular morphology analysis.

At nexacore.pk, researchers and laboratories throughout Pakistan can access premium-quality peptides, SARMs, nootropics, and performance-focused research compounds backed by strict quality standards and analytical verification.

Key Features

• Premium laboratory-grade synthetic peptide
• Derived from a p53 protein functional domain
• Approximately 30 amino acids in length
• Molecular weight of approximately 3526 Da
• High purity and quality assurance
• Suitable for membrane interaction and cellular signaling studies
• Certificate of Analysis (COA) available
• Exclusively intended for scientific and laboratory research

Chemical Properties

Peptide Sequence

H-RKKRRQRRRGLFGTPVDGHSERRVRSVRTRVLSQLR-NH2

Mechanism of Action

Membrane Targeting Properties

PNC-27 incorporates a membrane-localizing sequence that facilitates interactions with lipid bilayers in controlled experimental systems. Researchers employ this feature to investigate peptide-membrane dynamics and structural associations.

Interaction with Membrane Proteins

Laboratory studies examine how PNC-27 interacts with membrane-associated proteins expressed in cultured cells. These investigations focus on:

• Peptide binding characteristics
• Structural interactions
• Cellular signaling responses
• Biochemical pathway activation

Membrane Integrity and Cellular Response Research

Experimental observations indicate that PNC-27 may influence membrane stability and trigger intracellular signaling mechanisms associated with programmed cellular responses. These findings are explored exclusively in laboratory environments and are valuable for mechanistic investigations.

Research Applications

PureRawz PNC-27 is widely utilized in scientific studies involving:

Membrane Interaction Studies

• Peptide-lipid bilayer investigations
• Membrane stability analysis
• Structural interaction assays

Cellular Signaling Research

• Peptide-induced biochemical pathways
• Intracellular response mechanisms
• Molecular signaling studies

Apoptosis Pathway Investigations

• Programmed cellular response analysis
• Cell culture experiments
• Mechanistic peptide research

Oncology and Cell Biology Models

• Cell morphology investigations
• Membrane integrity studies
• Experimental cancer research models

These applications are strictly confined to laboratory and scientific environments.

Why Choose PureRawz PNC-27?

PureRawz is recognized for delivering premium research compounds manufactured according to rigorous quality standards. Each batch undergoes analytical verification to ensure consistency, identity, and purity.

Benefits Include

• High-quality laboratory-grade peptide
• Third-party analytical testing
• Certificate of Analysis included
• Excellent purity and consistency
• Reliable performance for research applications
• Trusted source for advanced peptide compounds

Buy PureRawz PNC-27 Peptide in Pakistan

If you are looking for premium peptides, SARMs, nootropics, and cutting-edge research compounds in Pakistan, nexacore.pk provides authentic laboratory-grade products supported by stringent quality control and dependable customer service. We are committed to supplying researchers and laboratories across Pakistan with reliable, high-quality compounds for scientific investigation.

Storage Recommendations

To maintain long-term stability and integrity:

• Store in a cool, dry environment.
• Protect from excessive heat and direct light.
• Follow standard laboratory handling procedures.
• Handle using appropriate protective equipment.

Disclaimer

PureRawz PNC-27 is supplied strictly for laboratory and scientific research purposes only. This product is not intended for human consumption, veterinary use, diagnosis, treatment, or prevention of any disease. All research should be conducted by qualified professionals following applicable laboratory regulations and safety protocols.